nkx6.2 (NKX6-2) Rabbit Polyclonal Antibody TA329659 from OriGene Technologies | Biocompare.com

Supplier Images

nkx6.2 (NKX6-2) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
nkx6.2 (NKX6-2) Rabbit Polyclonal Antibody

The nkx6.2 (NKX6-2) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to NKX6-2. This antibody recognizes Human antigen. The nkx6.2 (NKX6-2) Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit Polyclonal anti-NKX6

Product Specs
Itemnkx6.2 (NKX6-2) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA329659
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetNKX6-2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-NKX6-2 antibody is: synthetic peptide directed towards the N-terminal region of Human NKX6-2. Synthetic peptide located within the following region: PLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDIL
NCBI Full Gene NameNK6 homeobox 2
NCBI Gene AliasesGTX, NKX6B, NKX6.2, SPAX8
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!